PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00014.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 505aa    MW: 57467.4 Da    PI: 6.9721
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00014.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox314.5e-103463831954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Rsa1.0_00014.1_g00006.1 346 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 383
                              665559******************************88 PP

2BELL122.61.7e-39209280172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              erq+lq+kk+kLl++ +eVdkrY+qy++q+++++ssFe+v+glg+akpYts+Al++iSrhFrcL+dai+eqi
  Rsa1.0_00014.1_g00006.1 209 ERQDLQSKKNKLLTMADEVDKRYNQYYHQMEALASSFEIVTGLGAAKPYTSVALNRISRHFRCLRDAIKEQI 280
                              799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.7E-47137278IPR006563POX domain
PfamPF075261.6E-45143276IPR006563POX domain
PROSITE profilePS5007112.503324387IPR001356Homeobox domain
SMARTSM003896.5E-10327391IPR001356Homeobox domain
CDDcd000862.46E-11327388No hitNo description
SuperFamilySSF466897.7E-18328395IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28330393IPR009057Homeodomain-like
PfamPF059206.2E-18344383IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MQPLYQEESI YLNEQQQQAS TSSAASFSGV GGLHIPNSGG AVPNEMVFIP PTSDTGLTGN  60
VTVSSNDLSF QGGGLSLSLG NQIQYHHYQN LSNQLNYGND ENGKSLSHHH HQSEQTPSTG  120
GYSNGVGFYN NYRYETSGFV SSVLRSRYLK QTQQLLDEVV SVRKDMKLGD SSNKKTKNNK  180
DYKCQDFTNG SSDNNRENDK LQEELSPQER QDLQSKKNKL LTMADEVDKR YNQYYHQMEA  240
LASSFEIVTG LGAAKPYTSV ALNRISRHFR CLRDAIKEQI QVIRGKLGEK ETSEEQGERI  300
PRLRYLDQRL RQQRALHQQL GMVRPSWRPQ RGLPENSVSI LRAWLFEHFL HPYPKESEKI  360
MLAKQTGLSK NQVANWFINA RVRLWKPMIE EMYKEEFGDA SELLSNSNQD KNKMQETSQL  420
KHEDSSSSQQ QHFNNNNIAY TTTSSAEENL VFTDPKPGRA TATGDYDSLM NYQGFGVDDY  480
NRYIGLGNQQ DGRFSNPHQL HDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B3e-16333391563Homeobox protein Meis2
3k2a_A3e-16333391563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
GenBankAY0625450.0AY062545.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410; F1B16.6) mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
GenBankBT0001330.0BT000133.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013702113.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A078C8P10.0A0A078C8P1_BRANA; BnaC06g36180D protein
TrEMBLA0A0D3D0W50.0A0A0D3D0W5_BRAOL; Uncharacterized protein
STRINGBra015845.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3